Festival TACEC – Introducción

 

“Cosa tan natural era para Ocnos trenzar sus juncos como para el asno comérselos. Podía dejar de trenzarlos, pero entonces, ¿a qué se dedicaría?” [Goethe, Fausto]

 

¿Podemos encontrar una relación entre el ágora y el teatro? . La primera, aquella plaza de las ciudades griegas donde acontecía la asamblea pública y también el intercambio de conocimientos. El segundo, el espacio de contemplación ritual que comprendía la narrativa de una comunidad. En épocas antiguas estas dos acciones sociales compartían un mismo espacio arquitectónico junto también con los ritos y los deportes.  La misma inauguración del TACEC sucede en una transpolación arquitectónica similar.

Con Drumming de Steve Reich 4 percusionistas montados en la plaza seca central del teatro  hace exactamente 10 años, se creó el Centro de Experimentación y Creación en el subsuelo de la sala lírica.

El devenir histórico del Teatro Argentino de La Plata nos confronta con un enigma muy potente: ¿Qué es exactamente hoy un Teatro de Ópera? ¿Cuál es el valor que imprime a nuestra sociedad?

Suponiendo  que la cultura es la creadora del imaginario simbólico del ser argentino, podríamos  también conjeturar que al menos un teatro es un espacio de reunión pública.

La función de esa reunión es lo que está cambiando de un modo sigiloso en el Siglo XXI en los más importantes centros performáticos, museos e instituciones culturales en todo el mundo.

La representación se hace tan porosa ante la realidad, o la realidad se ha vuelto tan ficcional que un Teatro puede ser también un creador de protocolos relacionales y afectivos.

Esta incumbencia del arte en lo político que aparenta ser tan radical, no lo es , si uno se remite a los materiales. Solo que hoy los materiales son múltiples formas de escucha, de mediación, de migración y de sustrato cultural.

Como la inflexión vocal del quinto libro de Madrigales de Monteverdi, la aparición de las tubas wagnerianas en la Tetralogía, el chispazo folklórico de la viola feldmaniana en el clímax de Rothko Chapel ,  o las cámaras de video como instrumentos en Steen Andersen, todo se trata siempre, de objetos musicales que duran y se organizan en el tiempo.

El Festival TACEC nos da la posibilidad de acceder a obras  que pueden claramente representar el pensamiento musical de comienzos del siglo XXI.

Pero también hemos intentado ampliar la experiencia de la escucha contemplativa propia de un teatro a un espacio de intercambio y convivencia entre artistas de la Argentina del mundo. Jóvenes músicos y compositores que pueden intercambiar sus ideas con maestros de la escena mundial. El TACEC Generación corporeiza el ágora en donde se propone un espacio abierto de discusión y acción. Como si fuera un espectáculo en sí mismo, se instalará en un nuevo espacio, los viejos locales de calle 9 transformados en una galería y un laboratorio de pensamiento escénico.

La capacidad instrumental del Trío Catch y Séverine Ballon se encontrará con el ensamble de talentosos músicos argentinos que nos acompañan desde largo tiempo. Y se estrenarán dos obras que el Teatro Argentino ha encargado al compositor estadounidense Evan Johnson y la compositora platense Carolina Carrizo.

Bienvenidos al Festival TACEC y al Teatro Argentino de La Plata, que sigue trenzando, como Ocnos, sus juncos. Porque si no ¿a qué se dedicaría?

Matrices filosóficas de la música experimental

En la emergencia de las prácticas de la llamada ‘música experimental’ enumeraremos algunos topoi que resultan centrales para entender el devenir de estas acciones en el siglo XX y comienzos del XXI:el lenguaje discursivo y su relación con lo sublime; el ruido; las músicas no-cocleares; la amplificación ; la suspensión del concepto de sujeto ; la dislocación y la buscabilidad.
Keywords: música experimental, ruido, arte sonoro, música contemporanea, buscabilidad

 

“In girum imus nocte et consumimur igni”

I. INTRODUCCIÓN

En la aparición de las vanguardias coinciden el advenimiento del boom tecnológico – marcado por la explosión capitalista empujada por la innovación necesaria de la guerra moderna – , la suspensión de la noción de individuo, y la reinvención del concepto ‘significado’. Esto último está dado por el llamado giro lingüístico y por la cosificación del arte. La estructura artística no tiene ya un significado como tal sino a partir de su uso. Deviene entretenimiento. A la perdida de su carácter absoluto se debe a que el arte se vuelve anti-profesional, pero también auto-reflexivo. La música comienza a concebirse a partir de una serie de experimentos que suspenden toda certeza. La duda es el material de la música experimental. El abandono de los significados en pos del uso pragmático de la música en la sociedad capitalista generó un movimiento contrario hacia la búsqueda personal de los significantes.

 

II. EL LENGUAJE

A partir del giro lingüístico enhebrado por Frege , Russel y Wittgenstein, la noción de que la misma naturaleza del lenguaje define lo que se puede pensar nos brinda la primera matriz que nos interesa.
En el atomismo lógico , se impone que los sonidos, imágenes y sensaciones individualizadas son los elementos constituyentes de la funcionalidad de cualquier proposición.
Esto hace centrar la práctica artística en torno a los constituyentes elementales u originarios de la materia estética.
Si el lenguaje de por si tiene una función territorial, el efecto de esta atomización del material lo convertirá en nómade, en cuanto a su sustrato, a la vez que generará un espacio local de conexión pura. [Deleuze-Guattari, 1987] La otra consecuencia será la suspensión del desarrollo de las formas ( como la creación de temas o la macroformalización-variación de los temas). No hay estructura, solo posibilidad de genesis. Las relaciones de movimiento y reposo se establecen en las condiciones iniciales pero son elementos informes. Una prueba de ellos es el aplanamiento general tanto en lo horizontal tiempo teleológico en algunas obras paradigmáticas de este momento (principios de siglo XX). Lo que antes era trascendente ahora se vuelve inmanente y unísono.
En este contexto habrá una simultaneidad entre la evolución en el concepto de ‘materialidad musical’ , y la transpolación del concepto de lo sublime.
En la modulación de esta categoría estética se liberan las regulaciones , bajo el predominio de la tekné, de que la obra debe responder al modelo enseñado como al gusto compartido del público, en fin, la representación de una virtud. Por el contrario, la nueva experiencia de lo sublime será provocar en un concierto un hecho, propiamente dicho, inaudito. No busca la identificación. Lo sublime se aparenta con lo monstruoso. [Klee, Jameson, Burke].
Imaginemos esto en términos históricos de finales de siglo XIX: el subconsciente de la gesamtkunstwerk wagneriana es omnipresente.
Se sitúa en el re-enfoque de la música en sus mecanismos internos en detrimento del contenido emocional-narrativo.
Se encierran en las dos primeras décadas del siglo XX, un rechazo general a los códigos del siglo pasado (por ejemplo en 1908 cubismo, 1909 futurismo)
En la disolución de la jerarquía tonal es la primera vez que surge no ya una secuencia temporal sino espacial. Lo importante es donde están ubicados los sonidos (en la serie) y no cuando suenan. El compositor es aquel que explora un espacio, un paisaje sonoro.
En la relativización de la música organizada por alturas comienzan a perder jerarquía los instrumentos tradicionales. los de percusión por ejemplo equiparan los usos de los demás instrumentos.
John Cage dirá que la música experimental nace oficialmente en 1945, con la bomba atómica, aquellos quienes la construyen también inventan la cibernética, la inteligencia artificial y la ciencia de la computación. [Cage, 1958] Su objetivo es legitimar socialmente que la experimentación es una entidad en si misma antes de terminar una obra, tal como los bocetos de un cuadro o los ensayos antes de una performance. La disolución de la forma es casi total. Se difumina un material compuesto porque al ser tocado – puesto en acto – es hecho antes de ser compuesto.
Con la re-captura de la notación de los silencios, se logra también “ escribir” o contener a los sonidos del entorno, abriendo la puerta de la música a los sonidos que suceden en él.
Todos estos enfoques vistos desde la escritura pueden configurar distintos momentos de cristalización de ideas experimentales. Si pudiéramos tornar en paleta los diferentes acercamientos a la fijación de ideas podemos diferencias algunos aspectos en la definición del grama.
El n-grama musical puede ser redefinido en su intervalo resonante.
La música europea propuso por cuatro siglos construir estructuras cognitivas que sean fundamentalmente narrativas y emocionales. Tienen un propósito y son predecibles al sistema cognitivo: el nivel de anticipación libera a esta música de cualquier peligro.
En el surgimiento de lo experimental aumenta la interferencia lingüística, no solo por la suspensión del mensaje establecido sino por una complejización del n-grama, en otros términos, del canal de información, como veremos mas adelante. Si pudiéramos trazar la estela de la flecha wagneriana a través de Mahler, Strauss, Debussy (del martirio de San Sebastian ) llegariamos al prometeo de Scriabin, aquí ya el sonido no puede contener la furia tonal, y la musica se convierte en luz, por primera vez.
Al mismo tiempo, con el devenir del la primera mitad del siglo XX, si la vista puede ser considerada el portal del simulacro, lo que nos arroja en esta época a creer que la realidad es real es el sentido de la audición.
La catexis preconciente de nuestro sustrato común de escucha es el ruido. Una transpolación del concepto disonancia sensorial, explicado mas arriba.

III. EL RUIDO

La relación que existe entre la música y el ruido puede ser comparada a la que existe entre el concepto de infinito y la matemática. Así como la matemática es una entidad dentro del infinito, la música es una entidad dentro del ruido. Pero también en el ruido entran todas las representaciones y significados.[Whitehead] Es esta la potencia que la música experimental otorga al postmodernismo a partir de su desestratificación generalizada: “lo que quieras que signifique es lo que significa”. Esta suma libertaria absoluta retorna hacia el arte , en términos informacionales e irónicamente , en otro tipo de ruido.
La definición del ruido no es posible en estos términos, ya que por nuestra acepción anterior , no podríamos contenerlo satisfactoriamente en ninguna estructura finita.
Pero sí es posible su funcionalización. El objetivo de la teoría de la información, enunciada por Shannon en 1948, es establecer la base matemática por la cual un mensaje puede ser transmitido por un canal con la mínima distorsión (o ruido) posible. Un concepto fundamental de la teoría es el de la entropía, resumidamente, la cantidad de información promedio que contiene un mensaje, la medida de impredictibilidad de la información recibida. El ejemplo clásico es el de la moneda y el dado, la entropía de la moneda lanzada al aire (2 valores posibles) es 3 veces mas baja que la del dado (6 valores posibles). Los lenguajes establecidos tienen una entropía mucho mas baja que las prácticas experimentales donde las condiciones iniciales (el sustrato) de distribución de indeterminación se redefine de forma realimentada. Siempre que se transmite un mensaje habrá una cantidad de ruido residual.
Shannon lo llama entropía condicional o equivocación. En determinado aspecto esta equivocación es también información, desde el punto de vista del emisor, pero que interfiere con el mensaje intencional. Shannon necesitará restar esta interferencia al mensaje recibido para reconstruirlo. La equivocación puede ser valorada en fin como negativa, pero también como superávit de información, lo que no pertenece al mensaje original pero que aun lo llena de ambigüedad. La equivocación es ruido.
A diferencia de Shannon, Henri Atlan cambiará el signo de negativo a positivo de la equivocación-ruido al pensar este surplus como condición necesaria de la autopoiesis de un sistema. En otras palabras la capacidad re-organizativa de un sistema en un grado mayor de complejidad. Este cambio de signo estará marcado por la posición del observador , si está mas cerca de la fuente, por supuesto conocerá el mensaje en su completud y la equivocación o ruido será evaluada como interferencia. En cambio, si está mas cerca de la recepción el nivel de ambigüedad entre mensaje y ruido se igualará y surgirán instancias de convivencia positiva entre ambos. Mas aun, Atlan traslada este axioma a su campo de investigación , la biofísica , diciendo que: “Donde intervenga la evolución de una especie, no hay ningún mecanismo concebible mas allá de aquellos en donde eventos aleatorios ( mutaciones no-causales) son los responsables de la evolución hacia mayores grados de complejidad y mayor riqueza organizativa.”
Algo semejante puede proyectarse en la irrupción de la música experimental en su contexto histórico. Todo momento de articulación histórica significa un movimiento del observador desde el emisor al receptor, aumentando la ambigüedad de la entropía condicional. Como sucedió a principios del siglo XIV (1310-1370) entre la transición del ars nova al ars subtilitor con el abandono de la ballade en pos de la liberación rítmico-melódica del contratenor. O en los albores del XVII (1590 a 1610) si comparamos la tradición madrigalista con el advenimiento de la ópera, la compresión de la complejidad polifónica en la la linea melódica figurativa. La complejización no se da de forma pendular como suele verse a la periodización, sino en forma de espiral. Es una complejización termodinámica: la cantidad de energía intercambiada reversiblemente desde un sistema al universo de otro.[ Youngblood]. El arte irrumpe en el canal como el modo mas complejo de la complejización, es neguentrópico (la entropía que el sistema exporta para mantener el nivel de entropía bajo), es la différance [Derrida], difiere en el tiempo y se diferencia espacialmente de la entropia que lo circunda con el principio de su memoria. Toda escritura es un remanente, porque niega la temporalidad del Universo, siendo el Universo la expresión de una explosión que se extingue.

IV. LA DISNOVACIÓN

La aparente democratización de las nuevas tecnologías está acompañada por su función emancipatoria: el ser humano se extiende a otras posibilidades del cuerpo y del ser. Mientras la frontera hombre-máquina se simplifica, se torna a cada minuto mas confusa, encapsulando el saber tecnológico en unidades impenetrables.
Esto esta dando lugar a cultos y mitologías neo-tecnológicas que aspiran a resolver al “ser humano mal diseñado”
La conectividad permanente y la ubicuidad mediatizada.

Dentro del boom tecnológico asistimos al advenimiento de la era de la información y la comunicación. La sociedad tecno-científica es el núcleo de nuestros sistemas de creencia. En ella, la dualidad consumo/innovación se transforma en la fuerza conductora detrás de nuestra economía. La noción de innovación es la última herramienta retórica contemporanea, desplegada desde el campo tecnocientífico hasta los sectores de la política, el management, la educación y el arte.

Aquí es donde se instaura un sistema de “propaganda de la innovación”, como aquella ideología que sirve para resolver toda necesidad, todo problema o deseo a través de la producción de artefactos y conceptos que cambian constantemente.
Este accionar justifica la obsolencia tecnológica en nombre de una vitalidad económica de corto plazo. Cabe preguntar si esta prisa continua hacia la novedad y por ende la negación de los valores precedentes es una necesidad humana legítima y real, una tendencia intuitiva o es un fin en si mismo. Es la innovación la expresión de un ideal particular cuyo propósitos son dictados por meras opciones económicas e industriales?
Como es que muchos artistas han devenido en agentes tácitos de la popularización y la difusión de la innovación?
Que tipo practicas sean críticas, subversivas, poéticas o alternativas genera esta situación a cambio?
La innovación no está definida por el flujo de la invención humana sino por el capital. De hecho todos los conceptos neo-ludistas sobre la tecnología aparecen a partir del supuesto que la tecnología es sinónimo de innovación. El concepto innovación en realidad es una opción ideológica construida a partir del protocolo, ya de por si contradictorio , de la evolución indefinida y la obsolencia programada. Que proyecta, según Lyotard “el cinismo que esconde la desesperación que finalmente nada arribará”. [Lyotard, 1988].
Pero esta pretensión de pensar conspirativamente al capitalismo esconde un doble peligro. Es posible que esta misma situación pueda transpolarse a la cosificación del enrarecimiento, y que entonces la acción experimental no sea leída como una respuesta a la profesionalización del arte sino mas bien la necesidad del capitalismo de organizar la rareza.
Es aquí donde suele confundirse que la necesidad estética pase por la construcción de una novedad imaginaria representada por la fetichización del dispositivo a fin de satisfacer el hambre social por la novedad.
En este lugar es donde lo profundamente antiguo vendrá a validar lo profundamente innovador

Buscabilidad y Concatenación

En el siglo XXI lo que hasta aquí es ruido o saturación se convierte en el poder dinámico de la semantización de grandes corpus de conocimiento. Las técnicas de collage del siglo XX están ahora miniaturizadas en el uso cotidiano del cortar-pegar. La capacidad de búsqueda en un texto es también una forma de lectura. La web es a la escritura lo que la fotografía fue para la imagen. [Goldsmith.2013]. Podemos entender la implicancia de la buscabilidad en la música experimental si la comparamos a cualquier taxonomia utilizada para poder metódicamente describir un tipo de ruido. La variedad de los ruidos es infinita. Su mensura es una tarea ya propuesta por Luigi Russolo en 1913 [ Russollo, 1923]. Pero nunca la música ha tenido una posiblidad de semantización como en épocas recientes. La emergencia de la ‘recuperación de información musical’ (MIR, music information retrieval), es la disciplina que se ocupa de la extracción automática de determinados atributos timbricos (altura, intensidad, brillo, transitividad y centroide espectral) o de información de alto nivel como metadatos, de un potencialmente infinito corpus de datos digitales de sonido,a partir de la indexación automática por sus propias caracteristicas intrínsecas.
El paso previo de cualquier escala es una cuantización.
A partir de la comparación de estos descriptores tímbricos puede generarse un sistema relacional a partir del ordenamiento jerarquico, pero dinámico de cualquiera de estos parámetros.
La irrupción de la síntesis concatenativa significa la emergencia del primer instrumento musical semántico. El proceso de selección , ahora es parte del instrumento y no solo de la voluntad compositiva.
Si el nacimiento de la música experimental se basa en la disgregación de los elementos linguísticos, como hemos visto, y su instrumentalización , objetivación y suspensión de los sutratos aglutinantes, la aparición de los conectores semánticos a nivel microsónico puede deparar un cambio paradigmático tal que ya no sea posible identificar sus rasgos concomitantes (anti-teleogicidad, enrarecimiento, extrañamiento del sustrato) en las músicas semantizadas a partir del MIR. Escucha maquínica versus escucha humana, sistemas musicales que distribuyen la inteligencia entre compositor, interface y material. La noción de instrumento se expande hacia todos los actores del campo musical, conviertiendose en un enjambre conectivo y consciente que proyecta conexiones relacionales entre todos los participantes del concierto.

Conclusiones

Si transpolamos el concepto de disonancia sensorial al aparato fisiológico podemos suponer que el sentido de la disonancia es como el miedo a la oscuridad: cuando es que nuestra posibilidad de percibir el mundo se ve comprometida. Una respuesta límbica de valencia negativa que surge de la degradación de nuestro sistema auditivo. Podemos pensar la disonancia como el umbral especulativo por el cual nuestro sistema perceptivo complejiza su capacidad de procesamiento. Las artes experimentales significaron un ensanchamiento del canal informativo que se expandió hacia la hominización, el retorno a lo mas humano. El fin del individuo tal como lo conocemos desde el surgimiento del protestantismo (con su análogo en el canto monódico acompañado en la liturgia) tiene su aceleración mas potente a partir de esta propagación del efecto disonante, que equipara la experiencia musical (pero también la del cine o el teatro expandido) al de la alucinación , el trance o el ritual. Entendidos todos no ya solamente como una simbiosis de la sociedad humana, sino la inevitable simbiosis del cuerpo con la mente y la máquina. Tal vez el cine, los video juegos, los cien años de música experimental y la aun primitiva capacidad de escucha de los sistemas numéricos sean los primeros pasos de esta expansión.

 

Referencias

Hegarty, Paul. ‘Noise/Music: A History’ (New York: Continuum, 2007)
Attali, Jacques. ’Noise: The Political Economy of Music’
Kahn, Douglas. ‘Noise Water Meat’
Whitehead, James. ‘Un-sounding music, noise is not sound’
Chatonsky, Gregory. ‘Esthétique de la disnovation’. https://www.academia.edu/9251653/Esth%C3%A9tique_de_la_disnovation. [ua, octubre 2015] Vidal Jordi, “Simulacre et servitude”, Éditions Allia, 2007
Cage, John, 1958.
Deleuze G. et Guattari, F. “A Thousand Plateaus” (Minneapolis: University of Minnesota Press, 1987), 493.
Goldsmith, Kenneth “On Uncreative Writing”, Transmediale BWPWAP, Berlin, Febrero 2013, http://www.transmediale.de/content/kenneth-goldsmith [ua , octubre 2015] Atlan, Henri. “ On a Formal Definition of Organization:, Journal of Theoretical Biology 45 (1974): 295-304
“Noise as a Principle of Self-Organization”, 110.
Youngblood, Gene. “Expandede Cinema”, Dutton Paperback. New York 1970. (p64)
Russollo, Luigi, The art of Noise.

La Música Argentina y el Caranday

originalmente publicado en Estudios Musicológicos Tempranos

Reflexiones acerca de la opinión1 de Federico Monjeau sobre el concierto Escrituras Argentinas2.

Para saber qué es la música argentina contemporánea no hace falta hacer genéricas las ideas de un referente legitimador. Ni tampoco repasar la remanida bibliografía que justifica a la emergencia del concepto de Nación como un producto artificial.

En nuestro recorte  la música argentina es , simplemente, la música de concierto financiada por el erario público, en cualquiera de las divisiones de trabajo necesarias para la concreción de las ideas en sonido. A riesgo de ser tachada de  materialista,  esta noción describe lo que sucede en este estilo de música, tal vez el que más apoyo estatal tenga en la actualidad, contando la cantidad de subsidios, presupuestos de instituciones culturales, cargos públicos y universitarios de los principales referentes. Descarta la situación de la diáspora, ya que por definición, significa otro medio de subsistencia. Un compositor que se sitúa en otro medio, intenta adaptarse a la cultura de ese medio para sobrevivir,  como las lombrices y las semillas.

No sería en vano recordar que estamos discutiendo, dados semejantes recursos del Estado argentino, uno de los modos más importantes de reunión social simbólica, como es la naturaleza del concierto, y que es lo que allí se escucha, o debería escucharse.

 Para Gandini, (como también para Monjeau, quien lo entrevista en 2011 en el mismo diario3) , aún podía hacerse una diferencia entre las técnicas extendidas y las tradicionales. En resumen, aquellas técnicas ocupadas en extraer la clase de sonido para el cual los instrumentos tónicos fueron hechos, las notas musicales, y aquellas que recuperan lo que en una época fueron los sonidos residuales o evitables de los instrumentos.

El punto de divergencia total  reside en el concepto mismo de historia. Obligado a ser didáctico, diré que la historia de la extensión perceptual de la naturaleza del sonido sigue el mismo derrotero que la ampliación del concepto de consonancia en el espectro armónico. Y así como no debemos a nadie en particular el manejo reversible de las relaciones entre los armónicos, tampoco debemos a nadie únicamente, ni siquiera a Cage o a  Lachenmann, el hecho de que el material musical hoy en día sea dado en su totalidad  para ser compuesto.

Este material  incluye a la naturaleza del concierto, al gesto, a la acción instrumental, a la altura tonal y espectral, al concepto referencial del rito de la escucha.

Los problemas de la música de hoy ocurren en la intención, en el cuerpo, en el espacio, en la luz, en el sonido, la temperatura, en fin, en la ampliación del espectro sonoro hasta incluir otro tipo de vibraciones. La música como el arte de combinar velocidades.

Aun así, no hay nada de emisión tradicional del sonido en la emergencia histórica del trino, el pizzicato o el mordente en comparación al concepto de altura entonada. La misma noción de lo ‘extendido’ responde a una mirada exógena del material. Su valoración como tal siempre ha sido externa a la imaginación, tal como  aprendimos en las clases de Monjeau de la disputa Artusi-Monteverdi. Al menos el primero se centra en un problema técnico concreto. La discusión pasaba por la abandonada preparación de la disonancia, aquel sonido tosco y burdo si era atacado sin el contexto de abordaje y liberación adecuado. Mientras la imaginación de Monteverdi construía sin pausa la música del futuro, Artusi intentaba a contrarreloj encajar este nuevo mundo musical con términos paliativos como el ornamento o el canto acentuado4. La real invención de Monteverdi (o de su época) es un completo cambio de foco de la construcción interválica a partir de la liberación del texto, por su incontinencia expresiva, sobre la trama musical. Es que la música siempre crece por la necesidad.

¿No nos fuerza Monjeau a la definición más burda y tosca del ruido como aquel sonido no deseado? Pero, ¿Cómo se puede desear lo que no se conoce?

Mientras se completa la opinión contextualizando un concierto del 2014 con compositores de hace 40 años (algo absolutamente impensable en las artes visuales, en el teatro, o en el cine) se invisibiliza por omisión obras presentes en el programa que fundan mundos estéticos completamente desconocidos5.

Por supuesto, está en todo su derecho. Pero no quisiera imaginar que en la sección económica del mismo diario, pueda juzgarse nuestro presente con categorías e ideas exclusivas de la era nixoniana o del gaullismo.

Podríamos suponer que el hecho de que se generalice con  el término ‘ideología’ se deba  a un sesgo cognitivo del tipo efecto ORE, similar a nuestra incapacidad perceptiva de los grados del blanco en el mundo esquimal. Por lo cual todo debe escucharse parecido.  Pero justificar la  ‘proliferación generacional  del ruido’ en un hábito de escucha propio de  ignorantes de la ‘Gran Tradición’ , ¿no suena a otro gesto temporizante de la crítica musical argentina que viene a enriquecer el habitual y amilanado silencio?

Porque si hay algo verdaderamente argentino es el reduccionismo monolítico hacia todo lo distinto. Es que con la cultura argentina pasa lo mismo que con los ambientes hostiles. En ellos los organismos que sobreviven tienden a autosostenerse y perpetuarse debido a la inclemencia del entorno. Esta idea parecería diseminarse transversalmente en un mismo modo de supervivencia: el monocultivo en el modelo agrario, el monopolio del contrabando en la política, y el pensamiento único en la cultura.  Se citan las mismas ideas y los mismos nombres, una y otra vez, como un mantra.

En otros medios, los organismos tienden a reproducirse promoviendo la transmisión de información. Y por ende la mutación, la diversidad que asegura la competencia. No se trata ni de atacar el modus operandi epigonal de los discípulos ideales simbiotizados con sus maestros (guarecidos en las seguras variaciones de la imitación)  ni de ponderar la independencia de un vacío ahistórico sino la de una internalización combinatoria de los materiales autorizados por el canon. Esta es la noción de historia que dialoga críticamente con las acciones del presente, y que defendemos en la plataforma que hemos creado.

Gandini, en la misma entrevista se excusa de opinar y otorga el beneficio de la duda.

Mi generación de compositores tiene el  desafío de asegurar la transmisión y mutación de información en un ambiente hostil. Mi propuesta es la siguiente:

Crear música con la lógica del Caranday, la especie de palmera  que habita en islas o renovales autónomos pero interconectados: desde los pantanales de Brasil, pasando por  el Gran Chaco, las sierras cordobesas  llegando hasta San Luís,  entre todos los tipos de climas, sociedades de conciertos, y entornos. Miran al sol, pero también crecen en la sombra, sobreviven a las sequías , a las críticas implosivas, a las heladas, a la indiferencia y a las inundaciones. Sus flores son protegidas por espinas o ideas muy agresivas y duras, al madurar sus frutos tiernos las semillas brotan violentamente de a cientos. Las viejas hojas del Caranday no caen al morir, sino que se apilan unas sobre otras, protegiendo y conformando su cuerpo, inventando su propia tradición. Tal como hacía Gandini con sus apropiaciones antropofágicas y sus  materiales, dejándolos reposar en su ropero. Solo algunos logran crecer y transformarse en árbol, pacientemente.

El  misterio de la música sobrevive a cualquier interpretación. Su signo resonante atraviesa cualquier fetichización del pasado. Su enigma se renueva en la colisión de las vibraciones con nuestros cuerpos puestos en movimiento.

Referencias

1. http://www.clarin.com/extrashow/musica/Condit-Auditorio_cheLA-compositores_jovenes-Ciclo_de_musica_cotemporanea_del_Complejo_Teatral_0_1252675181.html

2. http://condit.org.ar/escrituras-argentinas

3. http://www.clarin.com/espectaculos/musica/facil-pensar-ruido_0_437356276.html

4. ‘Seconda parte dell’Artusi’ (1603) y ‘Discorso Secondo Musicale’ (1608) bajo el pseudónimo de Antonio Braccino, Artusi llega a discutir la validez de la modulación , ya presente en Josquin , Gesualdo y otros, y que siglos después será el elemento técnico desestabilizador del sistema tonal.

5. Por nombrar algunas: la trama ambigua de la electrónica evanescente en la obra de Vazquez, utilizadas por Saariaho y Manoury. La escritura multiparamétrica de Araya que dialoga con la música de Estrada, Ferneyhough, Cedillo, el Manuscrito de Torino del ars subtilior, el ensamble formalmente atomizado presente en Klaus Huber y Sciarrino. La injerencia de la política implícita y explicita de Berio y Cage, en Pedernera. También Los vientos de la música conceptual y visual en la obra de Pelisch, de una desmesurada presencia en todos los ámbitos de la música actual desde hace años(Kreidler, stock11, Seidl, Beill). La música de los complejos sonoros donde la altura es una entre otras formaciones sónicas organizadas en estructuras multinivel, presentes en las músicas de Manassero y la mía propia (Maierhof, Czernowin, Billone ). Muchas de estas obras aun sostienen los complejos formales del último contrapunto de Bach o de la Gran Fuga de Beethoven aunque por supuesto con otro tipo de materiales. Si fuera útil, en los términos adornianos de la música informal (cuando no hay forma, todo se vuelve forma) aquella donde la era de los procesos motívico-temáticos sobrevive en la morfología musical pero con otra función y factura: un multimorfismo de polifonías disasociativas en sincronía con la multiperspectiva de la apariencia del sonido unitario. La complejización del material es una consecuencia directa de la liberación de la semántica inmanente de la música. Ideas que merecen futuras reflexiones.

La serie Tolosana

originalmente publicado en Espiral 3

Transferencia del gesto |[El ángel se pudre | 1997 | Bruselas]

El gesto dado por el músico, la gama por el compositor, la trama surge desde la experiencia vital. En el nacimiento de ese signo, el ornamento se vuelve estructural como lo es la mensura de un trémolo, la modulación tímbrica del vibrato, el marco nomenclatorio se suspende en pos de una geometría que se hace consciente (Gewordenheit) solo cuando suena. Todo es cristalino, reemplazando el conceptualismo y el constructivismo heredado del sistema tonal por invención en vez de elocución.

Método del Subrisio Saltatoris, la sonrisa que baila
[L’Endroit | 2001 | Córdoba]

El vínculo iguala el valor, niega la jerarquía, aumenta al infinito la reciprocidad dialógica, confrontar y afirmar es igual, ningun material tiene más razón que otro. Mutante y permanente vuelve a surgir siendo el mismo.

Al contrario de la caricatura, por ser, el caso del minimalismo burócrata o el cliché por excelencia de todo lo clásico como es la idea de que el refinamiento opera por división , donde el agente desdibuja sus rasgos individuales tratando de asemejarse a un grupo, el rasgo individual del compositor expande lo colectivo a una verdadera definición funcional del concepto de estilo.

Los elementos musicales no contienen implicaciones formales, no permiten sacar conclusiones sobre el todo, el sentido está dado por la destrucción y reconstrucción de convenciones, pero no es la exterioridad ficticia en el “sonido” dado por su objetivización. Asumir la asimetría, aceptar más que negar, que no haya afuera, que no haya exterioridad, con la lógica del saltimbanqui. Sonido que habita un lugar, partituras que evitan la generalización estandarizada, orquestada para nombres propios.

El abucheador solitario

Después de la primera ,todas las sociedades privadas y/o secretas de concierto estuvieron demás ,al haber tomado la condición del arte musical como el privilegio cínico y la posesión de un secreto que no debe ser develado, hasta que la repetición y parodia de esa forma social hizo que no haya secreto, ni arte, ni revelación.

Si un verdadero compositor lleva a
cabo un método que excede lo aprendido positivamente, su juego combinatorio estará rodeado por el razgo del pensamiento salvaje.

La violencia de la irrupción de un lenguaje que no se deja engañar por la necesaria ocultación bajo la forma de la sonrisa del santimbanqui. Muchas formas de amar, de ser argentino, de ser ignorante, cuando el accionar está dado sin reglas ni técnicas que no pueden ser aprendidas, ni constituirse

en un sistema alguno sino pendular entre el intento y la reflexión.

¿Hay algo para entender?

Al equiparar el decurso musical con la vida, se deconstruye el lugar común formal de la trama evolutiva del relato. El tiempo pasa a ser un paquete de fideos, tiempo de la vida y tiempo del mundo, instaurando el orden de la posibilidad por sobre el de la realidad.

El hombre que reflexiona por el Otro sobre sí mismo, en el tiempo de la vida mediante las dimensiones estables de la estructura temporal de la existencia (el tiempo del mundo). Dentro de un mismo tiempo del mundo, un sistema tubular de tiempos de
la vida distintivos pero unidos. La forma de lograrlo es la sincronía de la metáfora singular con la del mundo.

La transgresión del signo (il trapassar del segno) , es la recapitulación constante del pecado original , encarnado en Adán preguntando por la esencia de su pecado según el Bosco, por Ulises y su curiosidad según Dante. “Transgrede de manera repetida los signos establecidos del mundo habitable ‘asignado’ al hombre, para lanzarse a lo inhabitable “. Pero Colón sustituye a Ulises, Francis Bacon a Dante y la soledad a Dios, situación perfectamente reflejada en las pinturas de Arnold Schönberg.

[ Relatos Breves |2013 ]

La obra es una interferencia al estado de las cosas, la sensualidad resultante de los instrumentos de observación. Una cosmogonía que está dada por un modelo posible y efímero de conexiones, partiendo del reconocimiento de fenómenos de todas las dimensiones de la música, como si el espectro sonoro se transfiere también al movimiento solar, a la refracción de la luz. Cuando a la música no se le asigna ninguna intención, esta tiene el poder de la lluvia o del sol. La difracción del trazo escapa a cualquier proceso enfrentado a un patrón. Entonces la serie original ya no es definida por las cualidades estáticas que solo le pertenecen , sino que ella misma es un procedimiento de conectividad.

Cuando Tolosa habla sobre el origen de su música apunta en dirección a su diafragma y dibuja curvas en el aire.

En lengua guaraní “pensar” equivale a decir “sentir con el hígado”. Al igual que el amuyt‘aña aymara, la idea alude a un pensar memorioso y reflexivo, participativo y circular, que no tiene como sede el cerebro sino ese centro vital llamado chuyma, donde el corazón vibra al ritmo de la respiración. Podría decirse entonces que el pensamiento es un metabolismo con el cosmos, y que se nutre de savias vitales más vastas y densas que el mero cálculo racional. No podemos continuar confundiendo conocimiento con información.

Referencias

H. Blumenberg, “Der Prozess Der Theoretischen Neugierde”, en “Die Legitimität der Neuzeit” , Frankfurt am Main, Suhrkamp, 1973, p. 138-142.

Peter Sloterdijk, “Der ästhetische Imperativ”, 2007.

Rainer Maria Rilke, Élégies de Duino, París, Gallimard, 2007

pum!

detonadores para la música de aquí y ahora1

 

El mundo se orienta hacia la inversión sostenible. El abandono de los planes a corto plazo, propio de los ciclos del capitalismo que evidencia que luego de tres o cuatro generaciones los derechos a herencia y subsistencia se anulan mutuamente da lugar a la observación de ciclos extendidos que trascienden la perspectiva de una única vida humana.

Como un rallentando de la acción colectiva, tal vez por primera vez reflejado en obras tales como ORGAN/ASLSP de John Cage, ante la cual las ahora grandes extensiones de Feldman funcionarían como duraciones mínimas.

Los cambios en las formas de la percepción del tiempo han jugado en diferentes eras con toda la tecnología de la representación de la realidad.
Supongamos que la piedra basal de este edificio sea la representación del yo, del propio sujeto.

El pathos del infinito agustiniano, esa conciencia de tiempo propia del modernismo , definido por un lado por la melancolía de lo antiguo y la amnesia de lo moderno, definido como el deseo infinito, la nivelación de todos los ahoras en la comilona antofágica, construye un sujeto de una dialéctica existencial interior. De este diálogo tautológico surge la individuación.
Pero como el vehículo para esta acción es un lenguaje, sabemos que la creación de un lenguaje siempre implica la figura de un Otro, sea este el Dios del absurdo kierkegaardquiano, o el dialéctico de la contradicción interna, o el espejo objetivante de Lacan.
Cuando ocurre, ¿Será su vastedad polisémica lo que hace a la acción musical el instante de la realidad dilusoria?. ¿Puede un concierto (a la manera de los juegos artísticos de Mathias Fuchs o las masas en movimiento de Tino Sehgal) ser el momento de la modificación irreal?

La conclusión del desarrollo sostenible es muy simple: satisfacer la necesidad de la generación actual sin comprometer la necesidad de la generación futura.

Esta visión del futuro condicionado por una medida energética, implica como todo conteo, cierto sistema moral y un orden que le corresponde. Una alteración en el concepto de futuro y del contexto o ecosistema en el cual este se desarrolla. Y la condición, una geometrización del concepto “libertad”.

En el pensamiento musical, este axioma no es novedoso, los problemas entre forma y contenido han rodeado circularmente la historia de la música y del arte en general. A veces, cuando los contenidos desbordan las formas, develan la semilla de una nueva generación. Hoy, esa forma de desborde es nuestro planeta, y el contenido nosotros mismos. Ya no añoramos viajar a la luna, sino ser capaces por nuestros medios de “hágalo usted mismo” enviar nuestros teléfonos, cohetes caseros y hasta nuestras ojotas al espacio exterior.

La naturaleza ha servido como modelo en toda extensión de la percepción a la materia. Que otra cosa podemos llamar como tecnología a esta operación en principio mimética y luego genética.
El impulso de intelectuales que prefiguran los usos actuales, tienen como denominador común un campo de terreno peculiar, el jardín renacentista y barroco. Este jardín, mímesis del paraiso, creación intelectual y sensible al mismo tiempo puede rastrearse ya en Miltón y sus “aguas murmurantes” [Milton ,1667] o en Salomon de Caus y su órgano de Tívoli, de los primeros en corporeizar estos deseos. Ingeniero, paisajista y astrólogo diseña la mayoría de los instrumentos eólicos y muy probablemente, haya inventado así la máquina de vapor. A partir de Caus, Bacon escribe sus casas sonoras en su “Nueva Atlántida” y Athanasius Kircher construye sendos artilugios sonoros tales como el Phonurgia nova, especia de arpa eólica [Dreherr 1673] además de la maquina jesuítica.

La mutación de los modelos de la naturaleza, tan cambiante como las generaciones que la interpretan ha sido moldeado a la par de la invención de nuevas herramientas de medición . El descubrimiento del tiempo profundo, el hecho de que las formaciones rocosas evidencian una escala de evolución terraquea muchísimo mayor a los 6000 años bíblicos es una de ellas. Al cambiar la escala de observación, otrora la especie humana que solo conoce la transición entre estaciones y algún desastre natural aislado, abandona las teorías catastróficas (al igual que las creacionistas) y se hunde el mundo natural en una evolución lenta, transitiva e imperceptible.
Hace cien mil años se oyó por primera vez el crepitar del fuego, hace tres segundos escribí la palabra fuego.

En la escena psicológica, la compañía del Otro en el cogito cartesiano, en la conciencia del yo, llevó a ciencias como la psicología social, a generar novedosas estructuras para explicar los grupos humanos. Al mismo tiempo la formalización de los sistemas dinámicos nos han permitido comprender a los sistemas físicos que evolucionan con el tiempo [Poincaré, 1892]

¿Que queda allí del genio decimonónico, en su subjetividad máxima? ¿Que de la hormiga solitaria?, la recepción de estas ideas debidas a la proliferación de internet a principios del siglo XXI, y los institutos de las ciencias de la complejidad, aun guardan un enorme potencial de aplicación en todos los órdenes del comportamiento humano.
Dichas comunidades (las hormigas, el musgo) tienen características claves, se auto-organizan, son adaptativos, no están diseñados o compuestos, descubren nuevos senderos del modo mas económico posible, marcan el camino con feromonas, y saben que se debe hacer cuando se elige un nuevo sendero.
Con mucha frecuencia, cada vez que una nueva técnica traspasa la curva del ridículo en la sociedad occidental, su aparición llega acompañada de los alarmados gritos de los protectores de la tradición: este fue el caso del cine como lo fue también del libro. Y probablemente hace miles de años se haya discutido sobre la degradación que suponía la introducción de las tablillas de cera, cuando las planchas de mármol eran claramente mejores.

A la luz de esta ausencia de voluntad aparente en los sistemas dinámicos, cabe preguntarse ¿dónde está la frontera entre las acciones compositivas de la voluntad y el inconsciente, sea unitario o colectivo?,

En la interacción entre gen y experiencia, entre circuitos cerrados y la percepción del entorno, entre lo dado y lo adaptativo, las fuerzas intervinientes vuelven a ser azar y voluntad.
En el azar, las condiciones del entorno moldean ese otro azar de nuestra propia generación como ser el encuentro de nuestros progenitores y nuestra condición de proliferación, y entre la voluntad, la cualidad humana de inscribirse en la historia, de desarrollar narrativas que nos conducen. Desde la conciencia, cualquier pretensión política de un discurso artístico resultará falaz, por ser su materia mucho mas cercana a la lejanía que a la propaganda. La complejidad de la materia artística se nutre mucho mas de la inconsciencia del res extensa en oposición a la razón del cógitans.

En la música, esta se refleja en uno de los pilares del pensamiento lógico-musical: la polifonía. Si reducimos su estudio al fenómeno mas básico, el eco, como el espejo, construye una otredad sonora que se traslada al espacio y lo convierte en un tiempo poroso donde puede escucharse el pasado como algo estático.

Memoria del espacio, futuro construido a partir de la asignación de valor. Azar y voluntad, respectivos a la misma diferencia que existe entre emoción y sentimiento. Si puede notarse un rasgo sobresaliente en la actitud de los compositores actuales este sería el abandono de la solemnidad. La geometría conectiva nos exime de héroes huérfanos a la vez que convierte al pasado en vulnerable, se recupera la capacidad vital de los enunciados dinámicos. Las verdades se transfiguran en el reflejo de su entorno. Mutan en el espacio-tiempo. Parodia e historia se confunden en el achatamiento del presente. Nacidos al fuego de la canción, ( aun aquella que sigue sonando a jingle o que construye su canon estilístico a partir de los cambios de vestuario), anhelamos la energía de su génesis, canere y -tio, acción y efecto. Música como acción, como el encantamiento que produce patrones distintivos desde los mecanismos innatos y los aprendidos.

La obra ha dejado de ser un documento comprobatorio donde se afirma cual catálogo que se dominan las habilidades del standard cultural. Se libera de la recapitulación restaurativa de lo suficientemente probado. Pero esta operación sobre el sustrato referencial no ocurre por ignorancia de la tradición sino por su opuesto. La saturación de información ha dado paso al arte del saber borrar como valor legitimador en si mismo. Pero ya sin la carga solemne de la cantidad de austeridad. En la contención estética, más cercana a la pulcritud marcial que a la sobriedad carismática de Adolf Loos [Loos 1908], se encuentran dos direcciones morales, la pretensión por imposición, como el corte abrupto del contexto y la práctica del rechazo como virtud ética. Es el reino de lo subrepticio. Pero en si, es otro modo del barroco, un barroco invisible.
Desde allí se ve a lo numérico más que como acción concreta, como una portadora de síntomas temporizantes, como ser el desastre inminente y el progreso infinito.

Mejor, pensemos musicalmente al microprocesador. A principios del 2000, un transistor es la décima parte de un glóbulo rojo. Construido por dos principios: la composición flexible y materialidad latente. El procesador esta hecho para no importa que aplicación, correctamente debería ser utilizado al 30% de su capacidad, como la mente humana , la economía de recursos se encuentra en el encapsulamiento de objetos lógicos. Es una economía de la saturación infinitesimal. A más cantidad, más pequeño y menos consumidor de energía. Aunque su actividad de uso sea ínfima.

Estas calles de Buenos Aires, hechas de óxido y dejadez, donde a través de las eternas grietas crecen jóvenes yuyos que miran al cielo, el jilguero torna la hora de su canto, la luna se transforma en menguante, y todo indica la muerte de una temporada anunciando al mismo tiempo la llegada de la próxima.
Como esos cantos, la nostalgia se trastoca en indicio y fe, la certeza de lo que se espera.

En nuestra consciencia y alma de argentinos deberíamos seguir suponiendo que todos los elementos de la naturaleza aun los más pequeños forman parte del grito de los Dioses. Y protegerlos con el corazón. Por nuestro Otro que escucha sentimos el deseo de revivir y resucitar aquellos paisajes de vibraciones que han sido callados.

Para aportar su naturaleza al concierto y procurar a la vez ofrecer la fuerza de cada tiempo. Su estructura deberá ser completada con materiales cuyo aroma, timbre y textura interna evoquen nuestra versión del espacio-tiempo. Dejarnos caer sobre su hechizo. Absorber el espíritu que brota a través de la velocidad. Ningún otro sentimiento ha sido nombrado para ser sentido por primera vez como aquí, ya que no es posible ir más allá de lo que la naturaleza ha creado. Tal como que un ser humano no puede superar a la naturaleza, un músico no puede superar a los materiales.

 

referencias

Milton, John, “Paradise Lost. A poem in ten books.” Londres, Samuel Simmons, 1667; 2.ª ed. revis. y aument.

Kircher, Athanasius, “Phonurgia nova, sive conjugium mechanico-physicum artis et naturæ paranympha phonosophia concinnatum”. Kempten, Rudolphum Dreherr, 1673, p. 144.

Caus, Salomon de, “Hortus Palatinus a Friderico rege Boemiae electore Palatino Heidelbergae exstructus”. Fráncfort, Johann-Theodor de Bry, 1620

Loos, Adolf , “Ornamento y Delito”, 1908. http://hasxx.blogspot.com.ar/2012/03/adolf-loos-ornamento-y-delito-1908.html [último acceso agosto, 2012]

Poincaré, Henri, “Les méthodes nouvelles de la mécanique céleste”. Gauthier-Villars et fils, 1892, Paris.

Textos fonéticos


{} entonación , si contiene alturas específicas deben entonarse lo más aproximadamente posible.
Las letras que no conforman palabras deben servir como moduladores tímbricos de la envolvente generada por la zona del tracto vocal.
() susurro, o descenso del tono y el carácter respecto al texto circundante.
<k k> keening o llanto, a la manera del canto femenino irlandés
den sprechsang
undo subtono
** multifónico ,stress de la cuerda vocal
yodeling, alternancia entre voz de pecho y cabeza
<q> mano sobre boca
~ chasquido
+ boca chiusa
> acelerar el pulso de lectura
< disminuir el pulso de lectura

Ninguno de los modos son indicadores de pausas, deben interpretarse dentro del continuo rítmico de la lectura.

Las pausas y valores de silencio pueden ser interpretadas desde la espacialidad del texto, sumando a las tradicionales de la puntuación y salto de línea, las horizontales de alineación de palabras.

Palabras en otros idiomas que el español podrían ser pronunciadas con sus fonemas de origen.


germen | imagen | ok | immanesntiserung | secreto | finalis arquímedes | if


Germen

2007

e

en

gen

men

{re }

germen

emerge.

merge_______

mer____

me.

n____

Imagen

2010

(
i i i i i ima exl ima exl ima exl o,s rc; o,a tv’ p.d rc;
<** X m # M 9 *X e k { 3 +m2 } rvl imd tbl und ynl ybd unl tvd **>
si caigo de un árbol y siento que los pelos de mis brazos me envuelven y sostienen, en 5000 años crecerán,

porque pensé en ellos, los derivaré a plumas y volaré.
() ((( edfr kiuj redf ujki redf jkiu redf jkiu edfrujki edfg ujkl edfg dfgt fgtr fgtre jkloiu jkloiuy kloiuyt kloiuytred kloiuytredfg kloiuytredfghj kloiuytredfghjkl >> kloiuytrewqasdfghjkl ))) hacia un lugar

>>>zxcdsa bnmkjh zxcdsa ( vbnmkjhgf zxcvbnm,)(( loiuytrewqazxcvbnjhgfdsaa ))

<** eco inr rvo ubw tbo ybq **>

De alli una extraño propágulo emerge haciendo semillas, de vid de uva y de flor sámara. Aquenio y vilano de una compuesta, que el viento lleva sin significado pero con deseo. El viento es puro deseo y cero significado.
(((qzpmweoifgjh ecom gfjkrtiu ecom fdjkrtiu rvin fgkjtqu ecom rqup ecom rqup t t t t t t n t t t t t t)))
<< "Ahora" es tan grande que todos los segundos qu{e}dan en Neptunes, (aun el sol ) se cae sobre el azabache de la madera, y nos tiramos al agua por última vez, las algas nos miran y las langostas, y mato para que comamos, un ~manjar de limón y arena, hjagpkrtj pkrtj << ( <~ prktj bdm sz*jfptk mnN˜ñ ã z s sh h pt ch k gj k g j k )

Ok

2006

Oookokooooko
Oookooooooko
Ooookoooooko
Ooookoooooko
Ookoookooooko
Ookooookoooko
Okooookooookoko
Ooookookoookoko
Okoookooooko
Okooookook
Ooooookookoo
Okookook
Oookooookoook
Oookokookoook
Oooookooo
Ookoko

Immanesntiserung

2010

Las instituciones nos guardaban de los peligros, luego, la reflexión cosmopolita fué solidaria
con la solidaridadsoolidaridadooooliralidadoooooooliradadoooooliraddadoooooooaddaaddoooooodadliiidiaoddirsolidarosildoaisdloriaosliroisalodirlsoaidrlisoadirlosialdorisoairlsoiadlrosiasodialsoriaosdlrioaisdlrsiadorrrrroooosialdodosaoidooosdioooosdioooosdioooadioooadioooadioooadioooidooooidoooodoioooodioooadioosooadioosooaidoisooadisoioasidoiosdiosdiosdiosdioaduosduoaduoduoduoaduosdydyusadyuaduydyodyuodyuodyuodyueryuiaasdyueriuasdyuiqeryqiueryqeryqeryqerqueryqeruyqeruqeruyeruyeruerureureuyreyreyreyireuydireufediureyfkerufyedirufyedkfefuryeiruefyedkrufeyrieudyeurekdufyerutyeeifueryedkfueryeuriteufyeuyeyfueyeuyeyufeydeufeydeifruyfyasdufyreyfusfreyfuadreyfuasdyfreuaifrdreyfusdreydufisydifueryssaidueryqueriqyeruqieruqyerufiedhvnefivhefivnefivhfrnvievierufeivvueiveivvienvvievievnevievneivneiveniveivenievnievnievnieviecnievoonievenievenievenievenievecwcnimievcwnievecwnievewcqnievecqxqnievrcwxniebrwcqnitbrvecwnirvuechwxgwseiveuceuevivuecluevoeluvoecluvoecludoevlueduoeludoleudleludoevlolcuelovueliconelivouelconelivoeiuclveoiculeovhelucoivoenceoivleihelicoidelheiocliehdihelicodeiudhleiceohdliehdoeihdlichedleoddiefuefiuedufiedufieudeoreideuriedufeoreidfueodfiureodfiuredofriedufroedfiredufroedifruedofriefrueatufrufraufrautdrautrafrutaurafrutafrutafruatfruaftufaufhyleyhldeyhlydehlyhedlyhdlyhlydeluweiliaerliaufoiweuiaoiweruiaowierueifalhfeoihaihfuhfeudhueaiudeaiudeaoideaiudeaoideaiudeaoideaiufrsoideaufrsoideaiufrsoideaiugtdoiadeiusrfoiaediusrfkjhaeruiasrvuiasrouvioavsiuaroavsiouavsiouavsoiuavoasoiuavoasiuvasovaiusvoasviuavosiavoasiocvaosiacvaossdcaiseuciefhedurduiduirdudureogehrfeohrfeohfrgjheforgiurfjhwrotuyrtuyworuytworuytwourytuwrtyesicvkecyscekveycesckevyesckevyesckevyescievkesycevkescyeveksceyveskcevyesckeveyscekvesycevkeceyscekvesyceviesckeveysceveskcevyescievkekceyvesieveksyefedyeruqeryqerirryeruyrrirruriuriurrieroerieroieoreioriorioriorioeiroeireireireireireireireireireireireireireuwerierureiwerreiwuerireiwerruierireuroaerriearueiraeiruearieuaireiareiaireiarueiraurefiehraifueriaufeifuraifuereifaufeitnatufneaiturefanfieirutiefurnitoerifurniteireofutfinruftienrfurniterufurntieurfintuteirfuerntieufeoriefurofuorfuoruforlufourlufourlufourlufourfluorfluorfluorflurofuerfuoeufrblurblubrlubrlubrlubrblurblurblubrlubrlubrurbuorbuorbuorburkyaketiaktetkmosskateksnkoosktamtoosmkatossomoteoosoaktamteoatmoeatmoetierotemaroteigeugeifuedifhedifuedirusrusrusrusrusrusruosruosruosruosrueofideifhedifjefeifeuafiedufeidfuedfiuedfuoeiaduefoadiefuweufwuevnoeinecploecplorvoatecplotuaiecltoaeoeclovutaiecpclvortapeclvotiapelcorivotieaocpevortoaielcorfivorutiautieuyueupautieuyoautoeuyiautoeutiyoauteiroet aotie aotueia roeitua erotiaut eoaitue roaitueroaitue
rai
raoiprancherfnreltnelahsthteldilemathenrpahaclerntrentae lahetosidlmemaparlahacerltfrneltlha estlhriedilema
eraprahflhacerlfrnentelestiedilapejjrlparalhacerlfrenteoahastltedilemahpr=araparahacerfrentehastethi
para hacer frente a este dilema.

2008

El secreto contado al oído, es a la música, lo que la carta a la literatura.
Una música de 1 y 2.
El comienzo de la ficción.
O el de la música, susurrando en la oscuridad a un gran invisible.

Finalis Arquímedes

2009

>>>>>Todo cuerpo sumergido en un líquido, experimenta un empuje de abajo hacia arriba igual al peso del volumen del líquido desalojado.

>>>>Todo cuerpo sumergido en un fluido, experimenta un empuje ascensional igual al peso del líquido desplazado.

>>>Todo cuerpo sumergido asciende con la fuerza peso del líquido desplazado.

>>Todo sumergido forzandose ascendente con el peso del líquido desplazado.

>Sumergido forzandose ascendente con el antes peso líquido.

< << <<<< Puj gli~ckk ui*P

If

2007

el riesgo de lo total,
es una estúpida madrugada,
sin embargo escribo,
y rehago lo moribundo, apasionace.

Falté de nuevo a la cita,
reviví el último instante,
colmé los sentimientos empecinados,
vislumbré la caída de la hora,
y fui corriendo hacia la si fuera,
hacia el horizonte,
donde limpio el cielo
con una pluma de perro belga,
me haría vestido de sombra
pues nadie me ve a lo lejos,
tangente y perpendicular reflejo,
del borde, lo áspero saboreo.
Abro la puerta, y lo escucho todo,
mis pasos, como la escarcha suelta
como un cinturón de estrellas derribadas,
como un ajado lenguaje de desperdicio.

Hablácemos,

u olvida la necedad del segundo,
por el edificio de la esperanza.

Estorbo mas que nunca, pero detras de la intension nflkexime,l ogra oereeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee